GLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVRQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYIYFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
蛋白標(biāo)簽:
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
產(chǎn)品提供形式:
Lyophilized powder Note: We will default ship it in lyophilized form with normal bule ice packs. However, if you request to ship in liquid form, it needs to be shipped with dry ice, please communicate with us in advance and extra fees for dry ice and dry ice box will be charged.
緩沖液:
Lyophilized from PBS, 6% Trehalose, pH 7.4
儲(chǔ)存條件:
Store at -20°C/-80°C upon receipt, aliquoting is necessary for
mutiple use. Avoid repeated freeze-thaw cycles.
保質(zhì)期:
The shelf life is related to many factors, storage state,
buffer ingredients, storage temperature and the stability of the protein
itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The
shelf life of lyophilized form is 12 months at -20°C/-80°C.
貨期:
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. Note: Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
注意事項(xiàng):
Repeated freezing and thawing is not recommended. Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity.
This is the major myelin protein from the central nervous system. It plays an important role in the formation or maintenance of the multilamellar structure of myelin.
基因功能參考文獻(xiàn):
three single nucleotide polymorphisms in PLP1 that were associated with interhemispheric integration via the corpus callosum in a previous study also are relevant for functional hemispheric asymmetries. PMID: 29435918
This study demonstrated that the plp and alpha-synuclein transgenic mouse model of multiple system atrophy showed the Progressive striatonigral degeneration. PMID: 29298733
Pelizaeus-Merzbacher disease (PMD) is an X-linked disorder caused by mutations in the PLP1 gene, which encodes the proteolipid protein of myelinating oligodendroglia. PMID: 29478609
Proteolipid protein 1 and contactin 1 gene variation modulates interhemispheric integration PMID: 27864734
Using whole exome sequencing, a novel pathogenic PLP1 missense mutation c.251C > A (p.Ala84Asp) was detected in a Moroccan family, allowing a diagnosis of Pelizaeus-Merzbacher Disease. PMID: 29486744
down-regulated in cord blood by prenatal smoking PMID: 28130959
Authors investigated the disease progression in mouse models carrying PLP1 point mutations previously found in patients displaying clinical features of multiple sclerosis. These mouse models show loss-of-function of PLP1 associated with neuroinflammation. PMID: 28173160
Review focusing on sequences in hPLP1 intron 1 DNA deemed important for hPLP1 gene activity as well as a couple of "human-specific" supplementary exons within the first intron which are utilized to generate novel splice variants, and the potential role that these sequences may play in PLP1-linked disorders. PMID: 28735559
it seems that the epitopes of some microorganisms mimicking PLP such as PLP58-74 might have a potential role in the initiation of Multiple Sclerosis. PMID: 27917626
Human induced pluripotent stem cells-derived oligodendrocytes from 12 individuals with Pelizaeus-Merzbacher and identified individual and shared defects in PLP1 mRNA expression and splicing, oligodendrocyte progenitor development, and oligodendrocyte morphology and capacity for myelination. PMID: 28366443
report a novel mutation of the PLP1 gene in two siblings with Pelizaeus-Merzbacher disease associated with a rare and protean neuroimaging finding of optic nerve enlargement PMID: 27793435
Identification and functional study of novel PLP1 mutations in Chinese patients with Pelizaeus-Merzbacher disease. We identified PLP1 mutations in seven male patients with PMD. PMID: 25491635
In major depressive disorder there was a significantly reduced expression of PLP1 mRNA. PMID: 25930075
Study investigated 17 unrelated Pelizaeus-Merzbacher disease subjects with copy number gains at the PLP1 locus including triplication and quadruplication of specific genomic intervals-16/17 were found to have a duplication-inverted triplication-duplication rearrangement product. PMID: 25749076
Myelin proteolipid protein is critical to regulating oligodendrocyte progenitor cell migration. PMID: 26311781
PLP1 splicing mutations may result in a wide variety of disease phenotypes through a combination of multiple molecular pathogenic mechanisms. PMID: 23771846
this study provides new insight into the genotype-phenotype correlations of patients with PLP1 splice-site mutations. PMID: 23711321
Insertion of an extra copy of Xq22.2 into 1p36 results in functional duplication of the PLP1 gene in a girl with classical Pelizaeus-Merzbacher disease. PMID: 26329556
Data strongly suggest that a secondary structure within intron 3 is important for controlling regulation of the PLP1 alternative splice and that patient mutations can cause Pelizaeus-Merzbacher disease by disrupting this structure. PMID: 24890387
Mutations found in the PLP1 gene are the cause of PMD in around 20% of the patients in this series. PMID: 23347225
Data suggest transmembrane segment of PLP contains multiple helix-helix interaction motifs that play role in ability of PLP to form dimers/oligomers; alteration of local hydrophobicity affects both helix-helix interaction and segment alpha-helicity. PMID: 24857611
show that the presence of the c.436C>G mutation served to introduce regulatory motifs that appear to be responsible for the perturbed splicing pattern that led to loss of the major PLP transcript PMID: 24019930
Our clinical and molecular findings showed that the phenotypic spectrum resulting from PLP1 mutations seems to be broader in patients with the PLP1 gene duplication compared to patients with both nonsense and missense mutation. PMID: 24519770
report a novel PLP1 missense mutation (c.88G>C) in a family from Argentina. This mutation is in a highly conserved transmembrane domain of PLP1 and the mutant protein was found to be retained in the endoplasmic reticulum when expressed in vitro PMID: 24103481
data show that complex duplications involving PLP1 are not uncommon, can be detected at the level of genome resolution afforded by clinical aCGH and duplication and inversion can be produced in the same event. PMID: 21623770
The PLP1 gene has a more complex role in human brain development, exceeding its structural function in myelin formation. PMID: 22511562
PLP1 mutants inhibit Golgi apparatus to endoplasmic reticulum trafficking and have a role in pathogenesis of Pelizaeus-Merzbacher disease PMID: 23344956
In transfected cells, oligodendrocytes & brain, PLP exists as a monomer or a disulfide-linked dimer via Cys108. Isoform DM20 is usually a monomer. Mutants causing Pelizaeus-Merzbacher disease form disulfide-linked, high-MW aggregates. PMID: 22902553
the underlying effect of the partial PLP1 duplication identified in this study was different from other PLP1 alterations including a typical duplication and a missense mutation. PMID: 22695888
expression of PLP1 in oligodendrocytes markedly inhibits their differentiation, and that this inhibitory effect is effectively improved by inhibition of extracellular signal-regulated kinase activity. PMID: 22750001
A novel PLP1 mutation was found in a family presenting with X-linked recessive Hereditary Spastic Paraplegia. PMID: 22343157
Inflammation in mammals with increased Plp1 gene dosage may also contribute to axonal degeneration described in patients and transgenic rodents with PLP1 increased gene dosage. PMID: 20885931
Data suggest that a defective disulfide bond in proteolipid protein 1 could be important in the pathogenesis of Pelizaeus-Merzbacher disease. PMID: 21177054
study of patients with PLP1-related disorders; PLP1 gene duplications were identified in 24 of unrelated patients whereas a variety of intragenic PLP1 mutations were found in the remaining 14 patients; of the 14 different intragenic lesions, 11 were novel PMID: 21679407
Results prove for the first time the interaction of PLP and MAL2 in oligodendrocytic cells, supporting the transcytotic model of PLP transport previously suggested. PMID: 21573057
Central nervous system myelination is compromised by overexpression of proteolipid protein PLP/DM20 in a transgenic mouse model of Pelizaeus-Merzbacher disease. PMID: 20629189
G Run-mediated recognition of proteolipid protein and DM20 5' splice sites by U1 small nuclear RNA is regulated by context and proximity to the splice site. PMID: 21127064
A patient with Pelizaeus-Merzbacher disease has duplication of all 7 exons of the PLP1 gene. This duplication was inherited from the patient's mother, who is an unaffected carrier of the mutation. PMID: 21082496
PLP1 gene mutations cause hereditary spastic paraplegia. PMID: 19955111
These results suggest for the first time that PLP may have functions in humans not only in oligodendrocytes but also in neurons and could be implicated in axono-glial communication PMID: 20036320
his study presented new mutation and variable sizes of duplications in patient with Pelizaeus-Merzbacher disease. PMID: 19328639
report on a family of two young boys and their mother who share the same unusual 4-bp deletion of the PLP1 gene: c51_54 del TTCC, causing truncation of the PLP1 in exon 2. The brain MRI appearances in this unique deletion, using MR imaging, are described. PMID: 20186781
A242V PLP1 mutant, which causes severe Pelizaeus-Merzbacher disease, was more stable and accumulated at the endoplasmic-reticulum. PMID: 19825935
PLP1 deletions are likely caused by nonhomologous end joining PMID: 12297985
A PLP splicing abnormality is associated with an unusual presentation of PMD. PMID: 12325077
a study of the mutations in Pelizaeus Merzbacher disease. PMID: 12491939
Decreased expression of a number of myelin-related genes, including myelin basic protein (MBP), proteolipid protein (PLP), and myelin-associated oligodendrocyte basic protein (MOBP) was noted in nucleus accumbens of cocaine abusers PMID: 15009677
A Korean boy diagnosed with SPG2 caused by a mutation that results in a Pro215Leu substitution in the second extracellular domain. PMID: 15450775
Mutations are associated with Pelizaeus-Merzbacher disease and spastic paraplegia type 2. (review) PMID: 15627202
the genetic polymorphisms within PLP1 in male are likely to confer an increased susceptibility to schizophrenia in the Chinese population. PMID: 15694262